PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00347g00712.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 145aa    MW: 16217.6 Da    PI: 6.3519
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00347g00712.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like50.45e-1610392655
                   G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                              +AtPk+i+++m+vkgLtl h+kSHLQkYRl
  Peaxi162Scf00347g00712.1 10 EATPKAIMRTMGVKGLTLFHLKSHLQKYRL 39
                              7****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-6942IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-14940IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-10940IPR006447Myb domain, plants
PfamPF143796.7E-1683128IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MHMFSISLAE ATPKAIMRTM GVKGLTLFHL KSHLQKYRLG KQSQKDLDEA SKDGLTATYS  60
LESPCSGGTP QQLPASDLNE GYEVKEALRA QMEVQSKLHL QVEAEKHLQI RQDAEQRYII  120
MLEKACKMLA DQIIGGVVTE NDQET
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ7191411e-105AJ719141.1 Nicotiana tabacum cDNA-AFLP-fragment BSTT2-32-460, cultivar Bright Yellow 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009620524.12e-89PREDICTED: uncharacterized protein LOC104112344 isoform X1
RefseqXP_016488132.12e-89PREDICTED: uncharacterized protein LOC107808151 isoform X1
TrEMBLK4BQ325e-89K4BQ32_SOLLC; Uncharacterized protein
STRINGSolyc04g015290.2.12e-88(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97642027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-38G2-like family protein